Bnip2 Rabbit Anti-Human, Rat, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Bnip2, Each

Details:

This gene is a member of the bcl2/adenovirus e1b 19kda-interacting protein (bnip) family. Though the specific function is unknown, it interacts with the e1b 19kda protein which is responsible for the protection of virally-induced cell death, as well as e1b 19kda-like sequences of bcl2, also an apoptotic protector. [Provided by refseqsequence: velkeewqdedfpiplpeddsieadilaitgpedqpgslevngnkvrkklmapdisltldpsdgsvlsddldesgeidldgldtpsensnefeweddlpkpkttevirkgsiteytaaeekedgrrwrmfrigeqdhrv