Web Analytics
518-831-8000 sales@utechproducts.com

BNIP2 Rabbit anti-Human, Rat, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant BNIP2, Each

1,757.70

Details:

This gene is a member of the BCL2/adenovirus E1B 19kDa-interacting protein (BNIP) family. Though the specific function is unknown, it interacts with the E1B 19kDa protein which is responsible for the protection of virally-induced cell death, as well as E1B 19kDa-like sequences of BCL2, also an apoptotic protector. [provided by RefSeqSequence: VELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRV

Additional Information

SKU 10288002
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21843