Web Analytics
518-831-8000 sales@utechproducts.com

BSN, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant BSN, Each

1,318.98

Details:

Neurotransmitters are released from a specific site in the axon terminal called the active zone, which is composed of synaptic vesicles and a meshwork of cytoskeleton underlying the plasma membrane. The protein encoded by this gene is thought to be a scaffolding protein involved in organizing the presynaptic cytoskeleton. The gene is expressed primarily in neurons in the brain. A similar gene product in rodents is concentrated in the active zone of axon terminals and tightly associated with cytoskeletal structures, and is essential for regulating neurotransmitter release from a subset of synapses. [provided by RefSeqSequence: AQEHTFLATATTVSITMASSVFMAQQKQPVVYGDPYQSRLDFGQGGGSPVCLAQVKQVEQAVQTAPYRSGPRGRPREAKFARYNLPNQVAPLA

Additional Information

SKU 10288837
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22825