Btg2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Btg2, Each

Details:

The protein encoded by this gene is a member of the btg/tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the g1/s transition of the cell cycle. [Provided by refseqsequence: qealtehykhhwfpekpskgsgyrcirinhkmdpiisrvasqiglsqpqlhqllpseltlwvdpyevsyrigedgsicvlyeeaplaascglltcknqvllg