Web Analytics
518-831-8000 sales@utechproducts.com

BTG3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant BTG3, Each

1,757.70

Details:

The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: VDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSDEETSKEMEVKPSSVT

Additional Information

SKU 10287278
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21035