Web Analytics
518-831-8000 sales@utechproducts.com

C12orf30, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant C12orf30, Each

$ 1,757.70

Details

Mdm20 is a component of n-acetyltransferase complex b (natb). Human natb performs cotranslational n(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (starheim et al., 2008 [Pubmed 18570629]).[Supplied by omimsequence: tgkrfiekdiqypflgpvptrmggffnsgcsqcqissfylvndiyeldtsgledtmeiqeriensfkslldqlkdvfskckgdll

Additional Information

SKU 10289336
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23412