Web Analytics
518-831-8000 sales@utechproducts.com

C12orf30, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C12orf30, Each

1,757.70

Details:

MDM20 is a component of N-acetyltransferase complex B (NatB). Human NatB performs cotranslational N(alpha)-terminal acetylation of methionine residues when they are followed by asparagine (Starheim et al., 2008 [PubMed 18570629]).[supplied by OMIMSequence: TGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLL

Additional Information

SKU 10289336
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23412