Web Analytics
518-831-8000 sales@utechproducts.com

C17orf39, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant C17orf39, Each

1,757.70

Details

The multiprotein mediator complex is a coactivator required for activation of rna polymerase ii transcription by dna bound transcription factors. The protein encoded by this gene is thought to be a subunit of the mediator complex. This gene is located within the smith-magenis syndrome region on chromosome 17. [Provided by refseqsequence: dtgnsylcgylkikglteeyptlttffegeiiskkhpfltrkwdadedvdrkhwgkflafyqyaksfnsddfdye

Additional Information

SKU 10290005
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24319