Web Analytics
518-831-8000 sales@utechproducts.com

C17orf39, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C17orf39, Each

1,757.70

Details:

The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeqSequence: DTGNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYE

Additional Information

SKU 10290005
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24319