C17orf39, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant C17orf39, Each

Details:

The multiprotein mediator complex is a coactivator required for activation of rna polymerase ii transcription by dna bound transcription factors. The protein encoded by this gene is thought to be a subunit of the mediator complex. This gene is located within the smith-magenis syndrome region on chromosome 17. [Provided by refseqsequence: dtgnsylcgylkikglteeyptlttffegeiiskkhpfltrkwdadedvdrkhwgkflafyqyaksfnsddfdye