Web Analytics
518-831-8000 sales@utechproducts.com

C17orf70 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant C17orf70, Each

$ 1,757.70

Details

Faap100 is a component of the fanconi anemia (fa; mim 277650) core complex and is required for core complex stability and fancd2 (see mim 227646) monoubiquitination (ling et al., 2007 [Pubmed 17396147]).[Supplied by omimsequence: vlcsvspsgsrvphdllggsggftledalfgllfgadatllqspvvlcglpdgqlccvilkalvtsrsapgdpnalvkilhhleepvifigalktepqaaeaaenflpdedvhcdc

Additional Information

SKU 10287969
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21804