C17orf70 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant C17orf70, Each
$ 1,757.70
|
|
Details:
Faap100 is a component of the fanconi anemia (fa; mim 277650) core complex and is required for core complex stability and fancd2 (see mim 227646) monoubiquitination (ling et al., 2007 [Pubmed 17396147]).[Supplied by omimsequence: vlcsvspsgsrvphdllggsggftledalfgllfgadatllqspvvlcglpdgqlccvilkalvtsrsapgdpnalvkilhhleepvifigalktepqaaeaaenflpdedvhcdc
Additional Information
| SKU | 10287969 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21804 |
