Web Analytics
518-831-8000 sales@utechproducts.com

C2orf56, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C2orf56, Each

1,757.70

Details:

The function of this gene is not known, however, its existence is supported by mRNAs and EST data. Transcript variants encoding different isoforms have been noted for this gene.Sequence: ISVHLVEVSQKLSEIQALTLTKEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYSFYLAHEFFDVLPVHKFQKTPQGWREVFVDIDPQVSD

Additional Information

SKU 10290076
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24396