Web Analytics
518-831-8000 sales@utechproducts.com

C6, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C6, Each

1,757.70

Details:

C6 is a component of complement cascade. It is part of the membrane attack complex which can insert into the cell membrane and cause cell to lyse. People with C6 deficiency are prone to bacterial infection. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeqSequence: GLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELA

Additional Information

SKU 10289966
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24272