C6orf108 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant C6orf108, Each
$ 1,757.70
|
|
Details:
This gene was identified on the basis of its stimulation by c-myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-myc-mediated transformation. Two alternative transcripts encoding different proteins have been described. [Provided by refseqsequence: maaamvpgrseswergepgrpalyfcgsirggredrtlyerivsrlrrfgtvltehv
Additional Information
| SKU | 10288408 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22327 |
