Web Analytics
518-831-8000 sales@utechproducts.com

C8B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant C8B, Each

1,757.70

Details:

C8 beta is one of the three subunits that comprise the component 8 (C8) of the complement system. C8 participates in the formation of Membrane Attack Complex that results in the lysis of cells. Patients with C8B deficiency are prone to bacteria infection. [provided by RefSeqSequence: PCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

Additional Information

SKU 10287781
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21600