Cadm2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cadm2, Each
$ 1,317.60
|
|
Details:
Members of the large immunoglobulin (ig) superfamily, such as igsf4d, have diverse roles in extracellular recognition and intercellular adhesion (biederer, 2006 [pubmed 16311015]).[Supplied by omimsequence: eihytpsvkiipstpfpqegqpliltceskgkplpepvlwtkdggelpdpdrmvvsgrelnilflnktdngtyrceatntigqssaeyvlivhdvpntllpttiipslttatvtttvaittspttsattssirdpnala
Additional Information
| SKU | 10286817 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20492 |
