Web Analytics
518-831-8000 sales@utechproducts.com

Calb2 Rabbit Anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Calb2, Each

1,757.70

Details:

This gene encodes an intracellular calcium-binding protein belonging to the troponin c superfamily. Members of this protein family have six ef-hand domains which bind calcium. Three alternatively spliced transcript variants that encode different proteins have been described. [Provided by refseqsequence: magpqqqppylhlaeltasqfleiwkhfdadgngyiegkelenffqelekarkgsgmmsksdnfgekmkefmqkydknsdgkiemaelaqilpteenfllcfrqhvgssaefmeawrky

Additional Information

SKU 10286710
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20373