Web Analytics
518-831-8000 sales@utechproducts.com

CALY, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CALY, Each

1,757.70

Details:

The protein encoded by this gene is a type II single transmembrane protein. It is required for maximal stimulated calcium release after stimulation of purinergic or muscarinic but not beta-adrenergic receptors. The encoded protein interacts with D1 dopamine receptor and may interact with other DA receptor subtypes and/or GPCRs. [provided by RefSeqSequence: MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMI

Additional Information

SKU 10289798
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23919