Web Analytics
518-831-8000 sales@utechproducts.com

Cars Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cars, Each

1,757.70

Details

This gene encodes a class 1 aminoacyl-trna synthetase, cysteinyl-trna synthetase. Each of the twenty aminoacyl-trna synthetases catalyzes the aminoacylation of a specific trna or trna isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain of 11p15.5, An important tumor-suppressor gene region. Alterations in this region have been associated with the beckwith-wiedemann syndrome, wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [Provided by refseqsequence: hlfeqyrekrpeaaqlledvqaalkpfsvklnettdpdkkqmleriqhavqlateplekavqsrltgeevnscvevlleeakdllsdwldstlgcdvtdnsifsklpkfwegdfhrdmealnvlppdvl

Additional Information

SKU 10292504
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28665