Web Analytics
518-831-8000 sales@utechproducts.com

Ccbl2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ccbl2, Each

1,757.70

Details:

This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the rna binding motif protein, x-linked-like 1 locus on chromosome 1, but the coding sequences are nonoverlapping. [Provided by refseqsequence: vtgwklgwsigpnhlikhlqtvqqntiytcatplqealaqafwidikrmddpecyfnslpkelevkrdrmvrllesvg

Additional Information

SKU 10287971
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21806