Web Analytics
518-831-8000 sales@utechproducts.com

CCNB2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CCNB2, Each

1,757.70

Details:

Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control. [provided by RefSeqSequence: TVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLC

Additional Information

SKU 10286787
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20456