Ccnb2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ccnb2, Each

Details:

Cyclin b2 is a member of the cyclin family, specifically the b-type cyclins. The b-type cyclins, b1 and b2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and b2 differ in their subcellular localization. Cyclin b1 co-localizes with microtubules, whereas cyclin b2 is primarily associated with the golgi region. Cyclin b2 also binds to transforming growth factor beta rii and thus cyclin b2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control. [Provided by refseqsequence: tvssdlenidtgvnskvkshvtirrtvleeignrvttraaqvakkaqntkvpvqptkttnvnkqlkptasvkpvqmeklapkgpsptpedvsmkeenlcqafsdallckiedidnedwenpqlc