Cd163l1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cd163l1, Each

Details:

This gene encodes a member of the scavenger receptor cysteine-rich (srcr) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. The srcr family is defined by a 100-110 amino acid srcr domain, which may mediate protein-protein interaction and ligand binding. The encoded protein contains twelve srcr domains, a transmembrane region and a cytoplasmic domain. Alternatively spliced transcript variants encoding different isoforms have been described but their full-length nature has not been determined. [Provided by refseqsequence: lrvstrrrgsleenlfhemetclkredphgtrtsddtpnhgcedasdtsllgvlpaseat