Web Analytics
518-831-8000 sales@utechproducts.com

CD163L1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CD163L1, Each

1,757.70

Details:

This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. The SRCR family is defined by a 100-110 amino acid SRCR domain, which may mediate protein-protein interaction and ligand binding. The encoded protein contains twelve SRCR domains, a transmembrane region and a cytoplasmic domain. Alternatively spliced transcript variants encoding different isoforms have been described but their full-length nature has not been determined. [provided by RefSeqSequence: LRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDTSLLGVLPASEAT

Additional Information

SKU 10287111
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20835