Web Analytics
518-831-8000 sales@utechproducts.com

CDAN1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CDAN1, Each

1,757.70

Details:

This gene encodes a protein that appears to play a role in nuclear envelope integrity, possibly related to microtubule attachments. Mutations in this gene cause congenital dyserythropoietic anemia type I, a disease resulting in morphological and functional abnormalities of erythropoiesis. [provided by RefSeqSequence: NCVKHIKATLVADLVRQAESLLQEQLVTQGEEGGDPAQLLEILCSQLCPHGAQALALGREFCQRKSPGAVRALLPEETPAAVLSSAENIAVGLA

Additional Information

SKU 10289349
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23425