Cdan1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cdan1, Each

Details:

This gene encodes a protein that appears to play a role in nuclear envelope integrity, possibly related to microtubule attachments. Mutations in this gene cause congenital dyserythropoietic anemia type i, a disease resulting in morphological and functional abnormalities of erythropoiesis. [Provided by refseqsequence: ncvkhikatlvadlvrqaesllqeqlvtqgeeggdpaqlleilcsqlcphgaqalalgrefcqrkspgavrallpeetpaavlssaeniavgla