Cdc26, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cdc26, Each

Details:

The protein encoded by this gene is highly similar to saccharomyces cerevisiae cdc26, a component of cell cycle anaphase-promoting complex (apc). Apc is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. Apc thus is responsible for the cell cycle regulated proteolysis of various proteins. [Provided by refseqsequence: mlrrkptrlelklddieefenirkdletrkkqkedvevvggsdgegaiglssdpksreqmindrigykpqpkpnnrssqfgsl