Web Analytics
518-831-8000 sales@utechproducts.com

CDC26, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CDC26, Each

1,757.70

Details:

The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins. [provided by RefSeqSequence: MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSL

Additional Information

SKU 10289988
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24297