Web Analytics
518-831-8000 sales@utechproducts.com

CEACAM3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CEACAM3, Each

1,757.70

Details:

This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeqSequence: NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE

Additional Information

SKU 10286848
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20527