Web Analytics
518-831-8000 sales@utechproducts.com

CEP112, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CEP112, Each

1,757.70

Details:

This gene encodes a protein with filament, myosin tail and ATPase domains. Orthologs of this gene exist in mouse, rat and chimp. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeqSequence: RNTLHKEKDHLVNDYEQNMKLLQTKYDADINLLKQEHALSASKASSMIEELEQNVCQLKQQLQESELQRKQQLRDQE

Additional Information

SKU 10287874
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21702