Web Analytics
518-831-8000 sales@utechproducts.com

CERKL Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CERKL, Each

1,757.70

Details:

Ceramide kinases convert the sphingolipid metabolite ceramide into ceramide-1-phosphate, both key mediators of cellular apoptosis and survival. Ceramide metabolism plays an essential role in the viability of neuronal cells, the membranes of which are particularly rich in sphingolipids (Tuson et al., 2004 [PubMed 14681825]).[supplied by OMIMSequence: IARNTSRPEFIKHLKRYASVKNQFNFPFVETYTVEEVKVHPRNNTGGYNPEEEEDETASENCFPWNVDGDLMEVASEVHIRLHPRLISLYGGSMEEMI

Additional Information

SKU 10288879
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22874