Web Analytics
518-831-8000 sales@utechproducts.com

Chchd4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Chchd4, Each

$ 1,757.70

Details

Chchd4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -cxc-cx(9)c-cx(9)c- motif in the c terminus (hofmann et al., 2005 [Pubmed 16185709]).[Supplied by omimsequence: elvaddpndpyeehglilpngninwncpclggmasgpcgeqfksafscfhysteeikgsdcvdqframqecmqkypdl

Additional Information

SKU 10288826
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22814