Web Analytics
518-831-8000 sales@utechproducts.com

CHCHD4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CHCHD4, Each

1,757.70

Details:

CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIMSequence: ELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDL

Additional Information

SKU 10288826
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22814