Web Analytics
518-831-8000 sales@utechproducts.com

CHD1L Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CHD1L, Each

1,317.60

Details:

In response to DNA strand breaks, chromatin adopts a relaxed structure due to the addition of poly(ADP-ribose) (PAR) to chromatin proteins by PARP enzymes (see PARP1; MIM 173870), and this relaxation facilitates the repair of DNA damage. CHD1L interacts with PAR and has a role in chromatin relaxation following DNA damage (Ahel et al., 2009 [PubMed 19661379]).[supplied by OMIMSequence: AWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPR

Additional Information

SKU 10288194
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22069