Web Analytics
518-831-8000 sales@utechproducts.com

Chmp4b, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Chmp4b, Each

$ 1,757.70

Details

Chmp4b belongs to the chromatin-modifying protein/charged multivesicular body protein (chmp) family. These proteins are components of escrt-iii (endosomal sorting complex required for transport iii), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (mvbs). Some chmps have both nuclear and cytoplasmic/vesicular distributions, and one such chmp, chmp1a (mim 164010), is required for both mvb formation and regulation of cell cycle progression (tsang et al., 2006 [Pubmed 16730941]).[Supplied by omimsequence: svfgklfgagggkagkggptpqeaiqrlrdteemlskk

Additional Information

SKU 10291942
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27902