Web Analytics
518-831-8000 sales@utechproducts.com

CIB3 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CIB3, Each

1,757.70

Details:

This gene product shares a high degree of sequence similarity with DNA-dependent protein kinase catalytic subunit-interacting protein 2 in human and mouse, and like them may bind the catalytic subunit of DNA-dependent protein kinases. The exact function of this gene is not known. [provided by RefSeqSequence: FNNDDYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADG

Additional Information

SKU 10292059
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28132