Web Analytics
518-831-8000 sales@utechproducts.com

Cib3 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cib3, Each

$ 1,757.70

Details

This gene product shares a high degree of sequence similarity with dna-dependent protein kinase catalytic subunit-interacting protein 2 in human and mouse, and like them may bind the catalytic subunit of dna-dependent protein kinases. The exact function of this gene is not known. [Provided by refseqsequence: fnnddyicawdleqtvtkltrgglsaeevslvcekvldeadg

Additional Information

SKU 10292059
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28132