Web Analytics
518-831-8000 sales@utechproducts.com

CILP, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CILP, Each

1,069.20

Details:

Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. The encoded protein was thought to encode a protein precursor for 2 different proteins, namely CILP and a homolog of NTPPHase, however later studies identified no nucleotide pyrophosphatase phosphodiesterase (NPP) activity. One isoform of the protein, CILP-1, functions as an IGF-1 antagonist. [provided by RefSeqSequence: YKHESKLVLRKLQQHQAGEYFCKAQSDAGAVKSKVAQLIVTASDETPCNPVPESYLIRLPHDCFQNATNSFYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISKTEEREIQCSGYTLPTK

Additional Information

SKU 10292549
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28713