Ckb Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ckb, Each
$ 1,773.90
|
|
Details:
The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between atp and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as well as in other tissues, and as a heterodimer with a similar muscle isozyme in heart. The encoded protein is a member of the atp:guanido phosphotransferase protein family. A pseudogene of this gene has been characterized. [Provided by refseqsequence: vismqkggnmkevftrfctgltqietlfkskdyefmwnphlgyiltcpsnlgtglragvhiklpnlgkhekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvklliemeqrleqgqaiddlmpaqk
Additional Information
| SKU | 10292291 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28405 |
