Clec4c, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Clec4c, Each
$ 1,356.75
|
|
Details:
This gene encodes a member of the c-type lectin/c-type lectin-like domain (ctl/ctld) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene. [Provided by refseqsequence: mysktvkrlsklreyqqyhpsltcvmegkdiedwsccptpwtsfqsscyfistgmqswtksqkncsvmgadlvvintreeqdfiiqnlkrnssyflglsdpggrrhwqwvdqtpynenvtfwhsgepnnldercaiinfrsseewgwn
Additional Information
| SKU | 10282382 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22289 |
