Web Analytics
518-831-8000 sales@utechproducts.com

CLEC4C, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CLEC4C, Each

1,356.75

Details:

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeqSequence: MYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWN

Additional Information

SKU 10282382
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22289