Clk3 (M07a), Mouse Anti-Human, Clone: 7d6, Abnova, Mouse Monoclonal Antibody Raised Against A Partial Recombinant Clk3, Each
$ 922.51
|
|
Details
This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (sr) family of splicing factors. Two transcript variants encoding different isoforms have been found for this gene. Related pseudogenes are located on chromosomes 1 and 9. [Provided by refseqsequence: ypsrreppprrsrsrshdrlpyqrryrerrdsdtyrceerspsfgedyygpsrsrhrrrsrergpyrtrkhahhchkrrtrscssassrsqqsskrssrsv
Additional Information
| SKU | 10006435 |
|---|---|
| UOM | Each |
| UNSPSC | 12352200 |
| Manufacturer Part Number | H00001198M07A |
