Web Analytics
518-831-8000 sales@utechproducts.com

Cln5, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cln5, Each

$ 1,757.70

Details

This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (ncl). Also referred to as batten disease, ncl comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in ncl disorders is thought to be associated with lysosomal storage functionsequence: tltgknytmewyelfqlgnctfphlrpemdapfwcnqgaacffegiddvhwkengtlvqvatisgnmfnqmakwvkqdnetgiyyetwnvkaspek

Additional Information

SKU 10291949
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27910