Web Analytics
518-831-8000 sales@utechproducts.com

CLRN2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CLRN2, Each

1,757.70

Details:

This gene belongs to the clarin family of genes. The clarins appear to belong to a large superfamily of small integral membrane glycoproteins with four transmembrane domains. The exact function of this gene is unknown. [provided by RefSeqSequence: VKFHDLTERIANFQEKLFQFVVVEEQYEES

Additional Information

SKU 10289814
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23939