Web Analytics
518-831-8000 sales@utechproducts.com

COG5, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant COG5, Each

1,757.70

Details:

Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG5 (Ungar et al., 2002 [PubMed 11980916]).[supplied by OMIMSequence: SFWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVSHICFIEEIVKDGQPEIFYTFWNSVTQALSSQFHMATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFNASGTTDLYVD

Additional Information

SKU 10287503
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21288