Web Analytics
518-831-8000 sales@utechproducts.com

Copb2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Copb2, Each

1,318.98

Details:

The Golgi coatomer complex (see MIM 601924) constitutes the coat of nonclathrin-coated vesicles and is essential for Golgi budding and vesicular trafficking. It consists of 7 protein subunits, including COPB2.[supplied by OMIMSequence: VALGYDEGSIIVKLGREEPAMSMDANGKIIWAKHSEVQQANLKAMGDAEIKDGERLPLAVKDMGSCEIYPQTIQHNPNGRFVVVCGDGEYIIYTA

Additional Information

SKU 10289043
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23074