Web Analytics
518-831-8000 sales@utechproducts.com

COPS4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant COPS4, Each

1,757.70

Details:

This gene encodes one of eight subunits composing COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. [provided by RefSeqSequence: ALKHALHCTILASAGQQRSRMLATLFKDERCQQLAAYGILEKMYLDRIIRGNQLQEFAAMLMPHQKATTADGSSILDRAVIEHNLLSASKLY

Additional Information

SKU 10289047
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23079