Web Analytics
518-831-8000 sales@utechproducts.com

COQ9, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant COQ9, Each

1,757.70

Details:

Coenzyme Q10 (CoQ10), or ubiquinone, is a mobile lipophilic electron carrier critical for electron transfer by the mitochondrial inner membrane respiratory chain. COQ9 is 1 of several enzymes involved in biosynthesis of CoQ10 and likely functions in modification of the benzoquinone ring (Duncan et al., 2009 [PubMed 19375058]).[supplied by OMIMSequence: DQSTDFNWYTRRAMLAAIYNTTELVMMQDSSPDFEDTWRFLENRVNDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNL

Additional Information

SKU 10289608
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23716