Web Analytics
518-831-8000 sales@utechproducts.com

Cox19 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cox19, Each

1,757.70

Details

Cox19 encodes a cytochrome c oxidase (cox)-assembly protein. The s. Cerevisiae cox19 protein may play a role in metal transport to the mitochondrial intermembrane space and assembly of complex iv of the mitochondrial respiratory chain (sacconi et al., 2005 [Pubmed 16212937]).[Supplied by omimsequence: nfgtksfqprppdkgsfpldhlgecksfkekfmkclhnnnfenalcrkeskeylecrmerklmlqepleklgfgd

Additional Information

SKU 10287574
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21370