Web Analytics
518-831-8000 sales@utechproducts.com

CPAMD8, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CPAMD8, Each

1,757.70

Details:

CPAMD8 belongs to the complement component-3 (C3; MIM 120700)/alpha-2-macroglobulin (A2M; MIM 103950) family of proteins, which are involved in innate immunity and damage control. Complement components recognize and eliminate pathogens by direct binding or by mediating opsonization/phagocytosis and intracellular killing, and A2M is a broad-spectrum protease inhibitor (Li et al., 2004 [PubMed 15177561]).[supplied by OMIMSequence: SDLGLNNITAKALAYGDTNCCRDGRSSKHPEENHADRRVPIGVDHVRRSVMVEAEGVPRAYTYSAFFCPSERVHISTPNKYEFQYVQR

Additional Information

SKU 10288590
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22542