Cpm, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cpm, Each
$ 1,757.70
|
|
Details:
The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases a and b are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene. [Provided by refseqsequence: lktvaqnyssvthlhsigksvkgrnlwvlvvgrfpkehrigipefkyvanmhgdetvgrelllhlidylvtsdgkdpeitnlinstrihimpsmnpdgfeavkkpdcyysigrenynqydlnrnfpdafeynnvs
Additional Information
| SKU | 10292518 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28679 |
