Web Analytics
518-831-8000 sales@utechproducts.com

Cpsf3l Rabbit Anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cpsf3l, Each

1,757.70

Details:

The integrator complex contains at least 12 subunits and associates with the c-terminal domain of rna polymerase ii large subunit (polr2a; mim 180660) and mediates the 3-prime end processing of small nuclear rnas u1 (rnu1; mim 180680) and u2 (rnu2; mim 180690). Ints11, or cpsf3l, is the catalytic subunit of the integrator complex (baillat et al., 2005 [Pubmed 16239144]).[Supplied by omimsequence: lvgqaepesvllvhgeakkmeflkqkieqelrvncympangetvtlptspsipvgislgllkremaqgllpeakkprllhgtlimkdsnfrlvsseqalk

Additional Information

SKU 10288334
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22238