Web Analytics
518-831-8000 sales@utechproducts.com

CREM, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CREM, Each

1,757.70

Details:

This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeqSequence: QHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSD

Additional Information

SKU 10292369
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28489