Web Analytics
518-831-8000 sales@utechproducts.com

CRYL1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CRYL1, Each

1,757.70

Details:

The uronate cycle functions as an alternative glucose metabolic pathway, accounting for about 5% of daily glucose catabolism. The product of this gene catalyzes the dehydrogenation of L-gulonate into dehydro-L-gulonate in the uronate cycle. The enzyme requires NAD(H) as a coenzyme, and is inhibited by inorganic phosphate. A similar gene in the rabbit is thought to serve a structural role in the lens of the eye. [provided by RefSeqSequence: IRNALENIRKEMKLLEQAGSLKGSLSVEEQLSLISGCPNIQEAVEGAMHIQECVPEDLELKKKIFAQLDSIIDDRVILSSSTSCLM

Additional Information

SKU 10289551
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23654