Web Analytics
518-831-8000 sales@utechproducts.com

CTCFL Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CTCFL, Each

1,750.95

Details:

CCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation. This gene is a paralog of CTCF and appears to be expressed primarily in the cytoplasm of spermatocytes, unlike CTCF which is expressed primarily in the nucleus of somatic cells. CTCF and the protein encoded by this gene are normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation. [provided by RefSeqSequence: DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS

Additional Information

SKU 10286432
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20061