Ctss Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ctss, Each

Details:

The protein encoded by this gene, a member of the peptidase c1 family, is a lysosomal cysteine proteinase that may participate in the degradation of antigenic proteins to peptides for presentation on mhc class ii molecules. The encoded protein can function as an elastase over a broad ph range in alveolar macrophages. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [Provided by refseqsequence: nggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygredvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeywlvknswghnfgeegyirmarnkgnhcg