Cyp2w1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cyp2w1, Each
$ 1,757.70
|
|
Details:
This gene encodes a member of the cytochrome p450 superfamily of enzymes. The cytochrome p450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. [Provided by refseqsequence: vltgfeavkealagpgqeladrppiaifqliqrgggiffssgarwraarqftvralhslgvgrepvadkilqelkclsgqldgyrgrpfplallgwapsnitfallfgrrfdyrdpvfvsllg
Additional Information
| SKU | 10286928 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20619 |
