Web Analytics
518-831-8000 sales@utechproducts.com

Cyp2w1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Cyp2w1, Each

$ 1,757.70

Details

This gene encodes a member of the cytochrome p450 superfamily of enzymes. The cytochrome p450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. [Provided by refseqsequence: vltgfeavkealagpgqeladrppiaifqliqrgggiffssgarwraarqftvralhslgvgrepvadkilqelkclsgqldgyrgrpfplallgwapsnitfallfgrrfdyrdpvfvsllg

Additional Information

SKU 10286928
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20619