Web Analytics
518-831-8000 sales@utechproducts.com

CYTIP, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant CYTIP, Each

1,757.70

Details:

The protein encoded by this gene contains 2 leucine zipper domains and a putative C-terminal nuclear targeting signal, but does not have any hydrophobic regions. This protein is expressed weakly in resting NK and T cells. The encoded protein modulates the activation of ARF genes by CYTH1. This protein interacts with CYTH1 and SNX27 proteins and may act to sequester CYTH1 protein in the cytoplasm.[provided by RefSeqSequence: PAYSSYSTLTGSLTMDDNRRIQMLADTVATLPRGRKQLALTRSSSLSDFSWSQRKLVTVEKQDNETFGFEIQSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTEGF

Additional Information

SKU 10286701
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20364