Web Analytics
518-831-8000 sales@utechproducts.com

DCLRE1A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DCLRE1A, Each

1,757.70

Details:

DNA interstrand cross-links prevent strand separation, thereby physically blocking transcription, replication, and segregation of DNA. DCLRE1A is one of several evolutionarily conserved genes involved in repair of interstrand cross-links (Dronkert et al., 2000 [PubMed 10848582]).[supplied by OMIMSequence: TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFSSLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQSRAG

Additional Information

SKU 10289050
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23083