Dctn5, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Dctn5, Each

Details:

Dynactin (see mim 601143) is a multimeric protein essential for minus-end-directed transport driven by the microtubule-based motor dynein (see dync1h1; mim 600112). Dctn5 is a subunit of the pointed-end subcomplex of dynactin that is thought to interact with membranous cargo (parisi et al., 2004 [Pubmed 15043994]).[Supplied by omimsequence: lgellynkseyietasgnkvsrqsvlcgsqnivlngktivmndciirgdlanvrvgrhcvvksrsvirppfkkfskgv