Web Analytics
518-831-8000 sales@utechproducts.com

DDX46, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant DDX46, Each

1,757.70

Details:

This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a component of the 17S U2 snRNP complex; it plays an important role in pre-mRNA splicing. [provided by RefSeqSequence: KEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAM

Additional Information

SKU 10289001
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23023